Protein Info for PP_4977 in Pseudomonas putida KT2440

Annotation: 5,10-methylenetetrahydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 44% identical to METF_AQUAE: 5,10-methylenetetrahydrofolate reductase (metF) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00297, methylenetetrahydrofolate reductase (NADPH) [EC: 1.5.1.20] (inferred from 100% identity to ppu:PP_4977)

MetaCyc: 41% identical to 5,10-methylenetetrahydrofolate reductase (Escherichia coli K-12 substr. MG1655)
RXN-22438 [EC: 1.5.1.54]

Predicted SEED Role

"5,10-methylenetetrahydrofolate reductase (EC 1.5.1.20)" in subsystem Methionine Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 1.5.1.20)

MetaCyc Pathways

folate transformations III (E. coli) (9/9 steps found)
folate transformations II (plants) (10/11 steps found)
folate transformations I (9/13 steps found)
reductive acetyl coenzyme A pathway I (homoacetogenic bacteria) (3/10 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.20

Use Curated BLAST to search for 1.5.1.20 or 1.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D51 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PP_4977 5,10-methylenetetrahydrofolate reductase (Pseudomonas putida KT2440)
MQLAARRLLPEERLMSQERRYSFEFFPTKTDAGHEKLMGVARQLATYNPDFFSCTYGAGG
STRDRTLNTVLQLESEVKIPAAPHLSCVGDTKAELRALLAEYKAAGIKRIVALRGDLPSG
MGMASGELRYASDLVEFIREETADHFHLEVAAYPEMHPQARNFEADLANFVHKVKAGADS
AITQYFFNADSYFYFVERAQKLGVEIPVVPGIMPITNYSKLARFSDACGAEIPRWIRKQL
EAYADDTASIQAFGEEVITRMCEQLLQGGAPGLHFYTLNQAEPSLAIWNNLKLPR