Protein Info for PP_4975 in Pseudomonas putida KT2440

Annotation: Long-chain acyl-CoA thioester hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF03061: 4HBT" amino acids 17 to 92 (76 residues), 52 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: None (inferred from 96% identity to pen:PSEEN5034)

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D52 at UniProt or InterPro

Protein Sequence (133 amino acids)

>PP_4975 Long-chain acyl-CoA thioester hydrolase family protein (Pseudomonas putida KT2440)
MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIVQLGNQRVVTKYMSEINFVSAS
RQGDIIELGITATAFGRTSITLKCEVRNKITRKSILTVDKMVFVNLGEDGLPAAHGRTEI
KYVQDQFPDSAVE