Protein Info for PP_4971 in Pseudomonas putida KT2440

Annotation: putative Outer membrane-bound lytic murein transglycolase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF03562: MltA" amino acids 122 to 284 (163 residues), 197.1 bits, see alignment E=2.1e-62 PF06725: 3D" amino acids 307 to 378 (72 residues), 83.4 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 100% identity to ppu:PP_4971)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D56 at UniProt or InterPro

Protein Sequence (392 amino acids)

>PP_4971 putative Outer membrane-bound lytic murein transglycolase A (Pseudomonas putida KT2440)
MFAHDRNAHMKSALRHLAWTLPVLALLAGCNGGESAKPEPHAVATYAPATWKDLPPVSDE
DLLAGFYAWRNGCEKLKRDPVWAATCEAAGSATASAAQVRTFLEQNLQVYGLRSAENNAN
GLITGYYEPVYPGSLSQSATNHVAVYGIPDDMIVVDLASVYPELKGKRLRGRLEGRVLKP
YDTAEVINRNGVKAPVLAWLTDPMDLQFLQIQGSGRVQLEDGRQLRLGYADQNGHPYRPI
GRWLVEQGQLKKEEVSMGAIHAWAQANPQRVPELLASNPSYVFFSTRPDSNEGPRGSLNV
PLTAGYSVAIDRKVIPLGSLLWLSTTRPDGTPVVRPVGAQDTGGAITGEVRADLFWGTGP
EAGELAGNMKQQGQIWMLWPKGQPLPEVPKVP