Protein Info for PP_4959 in Pseudomonas putida KT2440

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 PF00072: Response_reg" amino acids 18 to 129 (112 residues), 85.4 bits, see alignment E=9.8e-28 TIGR00229: PAS domain S-box protein" amino acids 157 to 269 (113 residues), 24.5 bits, see alignment E=2.4e-09 PF13188: PAS_8" amino acids 157 to 193 (37 residues), 20.7 bits, see alignment 8.9e-08 PF00989: PAS" amino acids 157 to 250 (94 residues), 33.8 bits, see alignment E=8.8e-12 PF08448: PAS_4" amino acids 160 to 268 (109 residues), 29.4 bits, see alignment E=2.4e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 274 to 437 (164 residues), 130.9 bits, see alignment E=3.8e-42 PF00990: GGDEF" amino acids 278 to 435 (158 residues), 149.2 bits, see alignment E=2.7e-47 PF00563: EAL" amino acids 455 to 690 (236 residues), 225.7 bits, see alignment E=1.7e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4959)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D68 at UniProt or InterPro

Protein Sequence (708 amino acids)

>PP_4959 diguanylate cyclase (Pseudomonas putida KT2440)
MDGAYPQQQPLDGSSVLLVVDDYPENLISMRALLARQDWQVLTASSGIEALSALLEYEVD
LVLMDVQMPEMDGFEVARLMRGNQRTRLTPIIFLTANEKSEAAVLKGYASGAVDYMFKPF
DPQILKPKVQALLDQQRNRRMLQQLSRELETARAFNASILENAAEGILVVDAHGIIRFAN
PAISRLLAAPVQHLQGTQLLDVVQLTSTSLWRESDFYKAYQGRQIYRVHDAQLRTQGGEL
VPVALSCAPLPADQQAMVVTVLDMSAVRNLHQQLEYQAITDPLTGLLNRRGFYQAAEGAL
LRNERSDKAQALMYMDLDGFKRINDSLGHDAGDRVLRWVAEQLKDCLGSEALLARMGGDE
FTALFDSLPYPEQAGRFAERLLERVSISHEVDGLDVCLGVSIGIATYPDCGANVEGLLRS
ADAAMYAAKQAGRQQYRFYDQELNGRARSRLMLEDSVRMAIEQQDFTLVYQPQVAFHDGR
LRGFEALLRWQHPSVGDVPPGLFIPLLEEARLINRLASWIYRQGAAQRQAWYDRFPPDLV
LGISLSRAQFVMPGLVEELQRVIQLYQLVPTQLEVEVAETSLMYNIDAAVKQIHRLRELG
VRVALDDFGAGDCSLRMLRDLPIDTLKLDRHLVARLPDSTVDAALVRSVIGLCADYRITV
IAEGVETPAQAAWLKANGCEYVQGFLVAYPMTATDASGFPAIFSWPGP