Protein Info for PP_4938 in Pseudomonas putida KT2440

Annotation: putative Glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 101 to 115 (15 residues), see Phobius details PF20706: GT4-conflict" amino acids 157 to 369 (213 residues), 54.3 bits, see alignment E=1.8e-18 PF00534: Glycos_transf_1" amino acids 195 to 344 (150 residues), 100.3 bits, see alignment E=1.4e-32 PF13692: Glyco_trans_1_4" amino acids 212 to 344 (133 residues), 101.6 bits, see alignment E=7.1e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4938)

Predicted SEED Role

"Glycosyl transferase in large core OS assembly cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88D89 at UniProt or InterPro

Protein Sequence (379 amino acids)

>PP_4938 putative Glycosyl transferase (Pseudomonas putida KT2440)
MFNEVAVPPDLSGRGPMNIVNMMWAGGTPYMSIHKVHRQVLSNAGADARISNWLLLGSGL
CCGLGSTREWHMPSRALKGRHLWRLLRPWLRMRLRKALAEAGAEVVLLDGIGVARLVLPL
LQRIGHVRAKVLFHGKTRLHASDIRLLQSFPSERLSIAAVSQTLAESLERDLGRPVQTLR
MALDPLAFVEPLLNRDQARQALKLPQDAEVMLGAVGRLVESKGFEMLIEAFARASARQPG
LQLAIIGEGPQHAVLQQRIDALGLAERVHLRGHREDLQQLYRAFDWLLVPSRSEGLGLVV
QEAVMADVPVVCSDLEVFREQLRDTGGYLPVADESAWAEAIERCTALSASTIAAKQRQAL
APEQAWQAFCSGSQSLLRS