Protein Info for PP_4923 in Pseudomonas putida KT2440

Annotation: Outer membrane efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 29 to 451 (423 residues), 424.6 bits, see alignment E=2.2e-131 PF02321: OEP" amino acids 35 to 217 (183 residues), 96.1 bits, see alignment E=1.2e-31 amino acids 244 to 436 (193 residues), 107.4 bits, see alignment E=4e-35

Best Hits

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 99% identity to ppf:Pput_4799)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DA4 at UniProt or InterPro

Protein Sequence (477 amino acids)

>PP_4923 Outer membrane efflux protein (Pseudomonas putida KT2440)
MLRKLSLAIAVSCASNGVVWAADVPSTVKTDLVSVYQEAVDNNADLAAARADYGARREVV
PQARAGLLPNLSAGAEMMNTRTKLDEPSITSNRSGNSWSATLAQPIFRADRWFQLQAAEA
VNEQAALELSATEQNLILQTAQNYFAVLRAQDNLAATKAEEAAFKRQLDQSNERFDVGLS
DKTDVLQSQASYDTARANRIIAERQVQDAFEALVTLTNREYTSIQGVVHSLPVQVPTPND
AKAWVETAGRQNLNLLATNYAVSAAEETLRQRKAGHAPTLDAVAKYQKGDNDSLGFTNPS
QLGVRYSGDVEQTSVGLQLNIPIYSGGLTSSQVREAYQRLSQSEQQRESLRRQVVENTRN
LHRAVNTDVEQVQARKQSIISNQSALEATEIGYQVGTRNIVDVLDAQRQLYTSVRDYNNS
RYDYILDNLSLKQAAGTLSPQDLQDLKRYLKPDYNPDKDFLPPDLAAAAAKNFERRP