Protein Info for PP_4921 in Pseudomonas putida KT2440

Annotation: Transporter, NCS1 nucleoside transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 263 (28 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 317 to 334 (18 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 12 to 396 (385 residues), 82.2 bits, see alignment E=1.8e-27 TIGR02358: putative hydroxymethylpyrimidine transporter CytX" amino acids 23 to 416 (394 residues), 500.6 bits, see alignment E=1.7e-154

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4921)

Predicted SEED Role

"Predicted hydroxymethylpyrimidine transporter CytX" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DA6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>PP_4921 Transporter, NCS1 nucleoside transporter family (Pseudomonas putida KT2440)
MTSPSQFSPDHPIPIQQRIFGARDLFSLWFSLGIGLMVLQVGAMLAPGLGLAGAVLAIAL
GTGVGVLLLGAAGVIGSDTGLSAMGTLKLSLGSHGARLPALLNLLQLVGWGAFEIIVMRD
AASLLGARAFGEESAWNSPMLWTLCFGALATLLAVSGPLAFVRKVLRAWGIWLLLGACLW
LTWNLFAKADLAELWNRAGDGSMSLAVGFDIVIAMPLSWLPLIADYSRFARNGRHVFGGT
VVGYFIGNTWLMSLGVAYTLAFAASGEVNALLLALAGAGMGIPLLLILLDESEKAFADIH
SAAVSTGVLLPLKVEHLALAIGVLCTLIALLAPLAQYENFLLLIGSVFAPLFGVVLMDHY
VVRRRRLPAQVNGLHWQALVAWFTGVVAYHLIAAKAPELGATLPALLLAGVLHGLLSLSR
GRETVQA