Protein Info for PP_4909 in Pseudomonas putida KT2440

Annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 46 to 46 (1 residues), see Phobius details PF13740: ACT_6" amino acids 14 to 89 (76 residues), 77.4 bits, see alignment E=1.9e-25 PF21086: ACT_PSP_2" amino acids 109 to 191 (83 residues), 26.8 bits, see alignment E=1.3e-09 TIGR00338: phosphoserine phosphatase SerB" amino acids 188 to 406 (219 residues), 262.9 bits, see alignment E=2.3e-82 PF00702: Hydrolase" amino acids 203 to 375 (173 residues), 86.3 bits, see alignment E=1.2e-27 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 203 to 374 (172 residues), 112.4 bits, see alignment E=2.3e-36 PF12710: HAD" amino acids 204 to 371 (168 residues), 90.9 bits, see alignment E=4.4e-29 PF08282: Hydrolase_3" amino acids 339 to 405 (67 residues), 42 bits, see alignment E=2.9e-14

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to ppu:PP_4909)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DB8 at UniProt or InterPro

Protein Sequence (415 amino acids)

>PP_4909 phosphoserine phosphatase (Pseudomonas putida KT2440)
MRIFHRSRSQVVREIVLINITGEDRPGLTAAITGVLLQGGVSILDIGLAVMHGTLSFGIL
VDIPDNEVATALLQSVQAKAHELNLQARYTPISEADYQHWADGHGEARHIVTLLSRKITP
EQLQRVSAVISQYGLTIERIERLSARVALDAEIDKGKAAVEISVRGVPSDAQALRADFFA
LAEELSVDIAFQKDDLFRRNRRLAVFDMDSTLIEAEVIDELAKAAGVGEQVAAITERAMR
GELDFRASFKERMALLKGLDVGVLDEIGASLRLTEGAENLFAELKRLGYKTAILSGGFTY
FARQVQARLGIDYVFANELEVVDGKVTGVAVEPIVDAQRKADLLKKLASDEGLQLEQTIA
VGDGANDLPMLSLAGLGVAFRAKPLVRQSAKQAISTLGLDGVLYLLGLRDRDARG