Protein Info for PP_4904 in Pseudomonas putida KT2440

Annotation: Flagellar motor rotation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details PF13677: MotB_plug" amino acids 16 to 63 (48 residues), 63.9 bits, see alignment 7.9e-22 PF00691: OmpA" amino acids 167 to 257 (91 residues), 52.3 bits, see alignment E=6.3e-18

Best Hits

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 99% identity to ppf:Pput_4780)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DC3 at UniProt or InterPro

Protein Sequence (346 amino acids)

>PP_4904 Flagellar motor rotation protein (Pseudomonas putida KT2440)
MENNQPIIVKRVKRFGGGHHGGAWKIAFADFATAMMAFFLVLWLLSTATPEQKIAIAGYF
QDPIGFSESGTPYVIDLGGSPEMAPDKTINPEVKTEPTQQSPTQLSKDQVETMAEQVERE
RLELLLQELQNKVEENPQLQKFKDQILFEITQDGLRIQIMDAENRPMFDIGSARLQPYFE
DILLAMADTIKAVPNKVSISGHTDAKPYAGTGEYGNWELSANRANAARRALVAGGYPDGQ
VARVVGYASSSLFDRKDPFNPVNRRIDIIVLTKKAQRNIEGEQGAPETPPAAPTAPAAPA
SGAAPGASAPADPGATEQAPMQPRELRQKLNIFEDGTLKMDEAKEQ