Protein Info for PP_4901 in Pseudomonas putida KT2440

Annotation: conserved inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 31 to 43 (13 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details PF03458: Gly_transporter" amino acids 4 to 78 (75 residues), 81.5 bits, see alignment E=1.6e-27 amino acids 90 to 162 (73 residues), 75.7 bits, see alignment E=1e-25

Best Hits

Swiss-Prot: 57% identical to YICG_SHIFL: UPF0126 inner membrane protein YicG (yicG) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to ppg:PputGB1_4953)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DC6 at UniProt or InterPro

Protein Sequence (203 amino acids)

>PP_4901 conserved inner membrane protein (Pseudomonas putida KT2440)
MLLMLYLIAITAEAMTGALSAGRRGMDWFGVVLIACVTALGGGSVRDVLLGHYPLTWVKH
PEYLVLTSFAALLTIFIAPMMRRLRSLFLVLDALGLVAFTLIGCMTALEMGQGMLVASIS
GVITGVFGGILRDIFCNDIPLVFRRELYASVSFAAAWFYLGCVYFKVPAEQAMLLTLFGG
FLVRLLAIRFHWEMPKFHYNDQQ