Protein Info for PP_4896 in Pseudomonas putida KT2440

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 TIGR00585: DNA mismatch repair protein MutL" amino acids 6 to 314 (309 residues), 331.2 bits, see alignment E=4.4e-103 PF02518: HATPase_c" amino acids 26 to 81 (56 residues), 27.5 bits, see alignment 7.2e-10 PF13589: HATPase_c_3" amino acids 29 to 129 (101 residues), 44.2 bits, see alignment E=4e-15 PF01119: DNA_mis_repair" amino acids 218 to 333 (116 residues), 140.4 bits, see alignment E=4.4e-45 PF08676: MutL_C" amino acids 446 to 588 (143 residues), 168.6 bits, see alignment E=1.4e-53

Best Hits

Swiss-Prot: 100% identical to MUTL_PSEPK: DNA mismatch repair protein MutL (mutL) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to ppu:PP_4896)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DD1 at UniProt or InterPro

Protein Sequence (632 amino acids)

>PP_4896 DNA mismatch repair protein MutL (Pseudomonas putida KT2440)
MSGGSRIQLLSPRLANQIAAGEVVERPASVAKELLENSLDSGARRIDIEVEQGGVKLLKV
RDDGSGISADDLPLALARHATSKIRELEDLEGVLSLGFRGEALASISSVARLTLTSRTAS
ASEAWQVETEGRDMTPRVQPAAHPVGTSVEVRDLFFNTPARRKFLKAEKTEFDHLQEVIR
RLALARFDVGFHLRHNGKSILSLHEAHDEIARARRVGAICGPGFMEQALPIDVERNGLRL
WGWVGLPTFSRSQADLQYFFVNGRAVRDKLVAHAVRQAYRDVLFNGRHPTFVLFLELEPN
GVDVNVHPTKHEVRFREGRSVHDFLYGTLHRALADVRPEDQLAAPAAVPELVRPTGQQAG
EFGPQGEMRLASPVLEQPRAPQQSFSNGGSGAGYQYQYTPRPSQPLPAAEAQAVYREFYK
PLETGAAPATALPESQGDIPPLGYALAQLKGIYILAENAVGLVLVDMHAAHERIMYERLK
VAMASEGLSGQPLLVPETLALSQREADCAEEHAQWFQRLGFELQRLGPETLAIRQIPALL
KQAEANRLVQDVLADLMEYGTSDRIQAHLNELLGTMACHGAVRANRRLAIPEMNALLRDM
ENTERSGQCNHGRPTWTQMGLDDLDKLFLRGR