Protein Info for PP_4890 in Pseudomonas putida KT2440

Annotation: ATP phosphoribosyltransferase regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF13393: tRNA-synt_His" amino acids 12 to 321 (310 residues), 405.9 bits, see alignment E=1.2e-125 TIGR00443: ATP phosphoribosyltransferase, regulatory subunit" amino acids 15 to 324 (310 residues), 302.6 bits, see alignment E=1.4e-94 PF27460: HisZ_C" amino acids 334 to 390 (57 residues), 78 bits, see alignment E=3.8e-26

Best Hits

Swiss-Prot: 100% identical to HISZ_PSEP1: ATP phosphoribosyltransferase regulatory subunit (hisZ) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K02502, ATP phosphoribosyltransferase regulatory subunit (inferred from 100% identity to ppf:Pput_4766)

Predicted SEED Role

"ATP phosphoribosyltransferase regulatory subunit (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DD7 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PP_4890 ATP phosphoribosyltransferase regulatory subunit (Pseudomonas putida KT2440)
MATVDRWLLPDGIEEVLPPEAARIEIARRQVLDLFQSWGYELVVTPHIEYLESLLTGAGQ
DLDQRTFKVVDPQSGRLMGFRADFTPQVARIDAHTLRREGPSRLCYAGSVLHAQPRALST
SRSPIQLGAELYGDASPTSDVEVISLMLATLQLADVPDVHMDLGHVGIYRGLARAAGLSG
AVEQQLFDAMQRKAVDEVQALTADLPKDLGSMLRALVELCGGREVLAEARVRLGRAPASV
LAALDDLLAIADRLASRYPDLPLYFDLGELRGYHYHTGVVFAVFVPGEGQSIAQGGRYDD
IGADFGRARPATGFSTDLKTLVTLGRAEVVLPTGGIWMPDSGDAALWQQVCQLRNEGQRV
VQALPGQPLSAALEADCDRQLIQQDGRWQVLPLAQ