Protein Info for PP_4881 in Pseudomonas putida KT2440

Annotation: putative Iron ABC transporter, periplasmic iron-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01547: SBP_bac_1" amino acids 41 to 283 (243 residues), 79.9 bits, see alignment E=6.9e-26 PF13531: SBP_bac_11" amino acids 43 to 288 (246 residues), 80.6 bits, see alignment E=3.1e-26 PF13416: SBP_bac_8" amino acids 47 to 300 (254 residues), 74.1 bits, see alignment E=3.3e-24 PF13343: SBP_bac_6" amino acids 82 to 297 (216 residues), 83.5 bits, see alignment E=3.3e-27

Best Hits

Swiss-Prot: 45% identical to FBPA_HAEIN: Iron-utilization periplasmic protein (fbpA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to ppf:Pput_4761)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DE5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PP_4881 putative Iron ABC transporter, periplasmic iron-binding protein (Pseudomonas putida KT2440)
MTIRPQPLMRTLAAAVLSLVIGAPAAMADAPVTLTMYNGQHKEIGEAIAKAYEAKTGIHI
DIRKGSSNQLASQIIEEGDRSPADIIYTEESPPLNNLGELGLLAKIDDATLNMMPKEYVG
ANGTWMGITARTRIVVYNPKKVDEKDLPTTVMDFANPEWEGRVGYVPTSGAFQEQAVAIL
KMHGREATEEWLTGLKAFGKTYTNNMVALKAVEKGEVAAVLVNNYYWYALERERGKLDTK
LYYLADGDAGNLVTISGAGVVKASKHPKEAQALLNWMASEEGQRVITQTTAEYPLHKGMV
SDRGLKPFDELRPPKISPADLGNAEEAIELEREVGLL