Protein Info for PP_4870 in Pseudomonas putida KT2440

Annotation: Azurin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00127: Copper-bind" amino acids 21 to 149 (129 residues), 79.8 bits, see alignment E=8.4e-27 TIGR02695: azurin" amino acids 23 to 146 (124 residues), 176.9 bits, see alignment E=9.8e-57

Best Hits

Swiss-Prot: 73% identical to AZUR5_PSEPU: Azurin from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4748)

Predicted SEED Role

"Azurin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DF5 at UniProt or InterPro

Protein Sequence (149 amino acids)

>PP_4870 Azurin (Pseudomonas putida KT2440)
MFAKAVAVSLLTLASASVFAAECSVTVDSTDQMSYTSKEFTVDKSCKEFTVKLTHSGNLP
KNVMGHNLVISKTADMQAIATEGMSQGLDKDYLKADNAAIIAHTKMIGAPEKETEVKFDT
SKLEAGGDYSFFCTFPGHISMMKGKVIVK