Protein Info for PP_4868 in Pseudomonas putida KT2440

Annotation: Nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 118 to 135 (18 residues), see Phobius details TIGR01514: nicotinate phosphoribosyltransferase" amino acids 11 to 399 (389 residues), 488.4 bits, see alignment E=8.7e-151 PF17767: NAPRTase_N" amino acids 16 to 133 (118 residues), 112.8 bits, see alignment E=1.4e-36 PF04095: NAPRTase" amino acids 173 to 399 (227 residues), 296.8 bits, see alignment E=1.4e-92

Best Hits

Swiss-Prot: 100% identical to PNCB_PSEPK: Nicotinate phosphoribosyltransferase (pncB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 100% identity to ppu:PP_4868)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DF7 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PP_4868 Nicotinate phosphoribosyltransferase (Pseudomonas putida KT2440)
MMSESAFAERIVHNLLDTDFYKLTMMQGVLHNYPDADVEWEFRCRNGEDLRPYLGEIRNQ
LERLADLTLDDGQLAFLERISFLKPDFLRFLRLFRFNLRYVHVGIENDQLFLRLKGPWLH
VILFEVPLLAIISEVRNRNLHPHMRLAEARDQLYRKFDWLRAHASDDELAELQVADFGTR
RRFSSRVQEEVARVLRDDFPGRFVGTSNVDLAWKLDIKPLGTMAHEWIMAHQQLGPRLID
SQIAALDCWVREYRGLLGIALTDCITMDAFLGDFDLYFAKLFDGLRHDSGEPVAWAEKAI
AHYQKLGIDPMTKTLVFSDGLNLTRSLEIFRALRGRINVSFGIGTNLTCDIPGVAPMNIV
LKMTDCNGAPVAKISDEAAKTQCRDENFVAYMRHVFKVPSKE