Protein Info for PP_4865 in Pseudomonas putida KT2440

Annotation: High-affinity branched-chain amino acid transport system permease protein BraE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 324 to 349 (26 residues), see Phobius details amino acids 362 to 387 (26 residues), see Phobius details amino acids 399 to 416 (18 residues), see Phobius details PF11862: DUF3382" amino acids 22 to 119 (98 residues), 70.5 bits, see alignment E=1.2e-23 PF02653: BPD_transp_2" amino acids 127 to 412 (286 residues), 162.4 bits, see alignment E=1.3e-51

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to ppu:PP_4865)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DG0 at UniProt or InterPro

Protein Sequence (435 amino acids)

>PP_4865 High-affinity branched-chain amino acid transport system permease protein BraE (Pseudomonas putida KT2440)
MNMSVAKTASISETKGFDLKRSLLETIVAGLLALIVFGPVVGVVLDGYTFNAEPRRVAWL
VGGVMVGRFLLSLFLQTAPGQRMLLGFDSGGSGVHVTAPDYKSRLRYIIPALIVIAIVFP
IFANKYLLTVVILGLIYVLLGLGLNIVVGLAGLLDLGYVAFYAIGAYGLALGYQYLGLGF
WSVLPLAAIAAALAGCILGFPVLRMHGDYLAIVTLGFGEIIRLVLNNWLSFTGGPNGMPA
PSPTFFGLEFGRRAKDGGVPIHEFFGFEYNASLKFVFIYAVLFMVVLAVLYIKHRLTRMP
VGRAWEALREDEIACRSMGLNHVLVKLSAFTLGASTAGLAGVFFATYQGFVNPSSFTFFE
SALILAIVVLGGMGSTVGVVIAAFVLTVAPELLRSFSEYRVLLFGVLMVLMMIWRPRGLI
RISRTGVTPRKGVAP