Protein Info for PP_4845 in Pseudomonas putida KT2440

Annotation: putative Urea ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR03410: urea ABC transporter, ATP-binding protein UrtE" amino acids 2 to 232 (231 residues), 351.3 bits, see alignment E=1.1e-109 PF00005: ABC_tran" amino acids 17 to 161 (145 residues), 114.9 bits, see alignment E=4.7e-37

Best Hits

Swiss-Prot: 35% identical to BZTD_RHOCB: Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD (bztD) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 99% identity to ppf:Pput_4723)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtE" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DI0 at UniProt or InterPro

Protein Sequence (232 amino acids)

>PP_4845 putative Urea ABC transporter, ATP-binding protein (Pseudomonas putida KT2440)
MLKIDTLHQYYGGSHILRGLSFEAKIGEVTCLLGRNGVGKTTLLRCLMGLVPARDGSIEW
EGKPITALKPQQRVQAGIAYVPQGREIFPRLTVEENLLMGLSRFPAREAREVPAFIYELF
PVLEQMKQRRGGDLSGGQQQQLAIGRALASRPRLLILDEPTEGIQPSVIKEIGAVIRRLA
ERGDMAILLVEQFYDFAEALADQYLVMARGEIIQRGRGENMQAEGVRGLVTI