Protein Info for PP_4841 in Pseudomonas putida KT2440

Annotation: putative Urea ABC transporter, periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 30 to 387 (358 residues), 251.8 bits, see alignment E=1.5e-78 TIGR03407: urea ABC transporter, urea binding protein" amino acids 31 to 404 (374 residues), 602 bits, see alignment E=1.7e-185 PF13433: Peripla_BP_5" amino acids 31 to 406 (376 residues), 552.9 bits, see alignment E=3.4e-170

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to ppf:Pput_4719)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DI4 at UniProt or InterPro

Protein Sequence (421 amino acids)

>PP_4841 putative Urea ABC transporter, periplasmic protein (Pseudomonas putida KT2440)
MKRRSLIKALTLSASIAAMGLSWSIQAAETIKVGILHSLSGTMAISETSLKDMALMTIEQ
INAKGGVNGKMLEPVVVDPASNWPLFAEKSRQLLTQDKVAVVFGCWTSVSRKSVLPVFEE
LNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVEYLMSEDGGSAKRFFLLGTDYVYPR
TTNKILRAFLHSKGVADKDIEEVYTPFGHADYQTIVASIKKFSAGGKTAVISTVNGDSNV
PFYKELANQGLKATDVPVVAFSVGEEELRGIDTKPLVGHLAAWNYFESVDNPVNQKFVAD
WKAYAKAKGLPGADKAVTNDPMEATYVGIHMWAQAVEKAKSTDVDKVREALAGQSFEAPS
GFTLTMDKTNHHLHKPVMIGEIQDDGQFSVVWETEQPLRAQPWSPFIPGNDKRPDYAVKG
N