Protein Info for PP_4839 in Pseudomonas putida KT2440

Annotation: putative iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 414 to 441 (28 residues), see Phobius details PF03929: PepSY_TM" amino acids 13 to 396 (384 residues), 253.6 bits, see alignment E=3.9e-79 PF03413: PepSY" amino acids 67 to 117 (51 residues), 21.4 bits, see alignment 2.6e-08 amino acids 285 to 342 (58 residues), 20.4 bits, see alignment 5.4e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4839)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DI6 at UniProt or InterPro

Protein Sequence (455 amino acids)

>PP_4839 putative iron-regulated membrane protein (Pseudomonas putida KT2440)
MRGTRVSFYNLAWRWHFYAGLFVAPFMILLAITGIIYLFKPQLDPLLYRDLMVVEAGQHR
QGADTMLAEVRQAYPKGHIAQYLPPLNAARSAQFVVHDGGRELNVFVDPYSGKVLGEQDG
KQNLQAIARALHGELMVGTVGDRLVELAAGWGIVLVVSGLYLWWPRGRSGAGVLWPRLSA
RGRLFWRDLHAVTGFWGSALLLLMLVSGMTWTGLWGKQYADLWNRFPAAMWNDVPKSDQQ
ARELNSAHRQTVPWAMENTPMPQSGAHAEHAGHHMMSDMPAAPQVSVQQVEDIATSRQVE
LGYSITLPTTADGVFTIAVFADDPRNDATLHVDQYTGKVLADVRWHDYSPVARATELGVM
LHEGKMFGALNQIIILLVCLMILLGSVSGLVMWWKRRPEGGLGVPPLRHDLPRWKAAVAV
MLVLGVMFPLVGVSMVVMWGVDSLVVRRRRVLASA