Protein Info for PP_4834 in Pseudomonas putida KT2440

Annotation: SPFH domain/Band 7 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01145: Band_7" amino acids 24 to 194 (171 residues), 124.1 bits, see alignment E=3.4e-40

Best Hits

Swiss-Prot: 39% identical to QMCA_ECOL6: Protein QmcA (qmcA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4712)

Predicted SEED Role

"Putative stomatin/prohibitin-family membrane protease subunit YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DJ1 at UniProt or InterPro

Protein Sequence (284 amino acids)

>PP_4834 SPFH domain/Band 7 family protein (Pseudomonas putida KT2440)
MTSLIVVGAIALFVLITVFKGVRIVPQGEEWIVERLGRYHSTLKPGLNIVIPYMDVVAYR
LPTKDIILDVQQQEIITKDNAVIVANALCFAKVVDPQKASYGVQDFSFAVTSLTMTSLRA
IVGAMDLDEALSSREQIKARLRDAMSEQTEDWGVTVRSVEIQDIKPSENMQLAMERQAAA
ERERKADVTRAEGAKQAAILEAEARLQAARLDAEAQISLAEASARSISLVKEAVGNETVP
AMYLLGERYVGAMENLAGSSNAKVVVLPADLQETVRGLMGRNKI