Protein Info for PP_4827 in Pseudomonas putida KT2440

Annotation: Precorrin-2 C(20)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR01467: precorrin-2 C(20)-methyltransferase" amino acids 6 to 238 (233 residues), 222.3 bits, see alignment E=2.8e-70 PF00590: TP_methylase" amino acids 8 to 219 (212 residues), 161.6 bits, see alignment E=1.3e-51

Best Hits

Swiss-Prot: 82% identical to COBI_PSEAE: Precorrin-2 C(20)-methyltransferase (cobI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03394, precorrin-2/cobalt-factor-2 C20-methyltransferase [EC: 2.1.1.130 2.1.1.151] (inferred from 100% identity to ppu:PP_4827)

MetaCyc: 52% identical to CobI (Pseudomonas denitrificans (nom. rej.))
Precorrin-2 C(20)-methyltransferase. [EC: 2.1.1.130]

Predicted SEED Role

"Cobalt-precorrin-2 C20-methyltransferase (EC 2.1.1.130)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.1.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.130 or 2.1.1.151

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DJ8 at UniProt or InterPro

Protein Sequence (244 amino acids)

>PP_4827 Precorrin-2 C(20)-methyltransferase (Pseudomonas putida KT2440)
MMAPRGRLLGLGVGPGDPELITLKALRLLREAPVVGYFVAKGKRGNAFGIIEAHLQPEQT
LLPLVYPVTTEVLPAPLSYEQVISDFYDEASVQVAEHLDAGRDVAVICEGDPFFYGSYMY
LHDRLAQRYDAEVIPGVCSMLGGASVLGAPLVYRNQSLSVLSGVLPAQELKRRLADADAA
VIMKLGRNFPKVREVLAELGLDRRALYVERATMANQKIVPLDQVDPQSSPYFSLIIVPGE
KWQG