Protein Info for PP_4826 in Pseudomonas putida KT2440

Annotation: Precorrin-3B C17-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF11760: CbiG_N" amino acids 55 to 133 (79 residues), 80.8 bits, see alignment E=6.1e-27 TIGR01466: precorrin-3B C17-methyltransferase" amino acids 315 to 561 (247 residues), 282.1 bits, see alignment E=1.9e-88 PF00590: TP_methylase" amino acids 315 to 525 (211 residues), 93.7 bits, see alignment E=1.6e-30

Best Hits

KEGG orthology group: K13541, cobalamin biosynthesis protein CbiG / precorrin-3B C17-methyltransferase [EC: 2.1.1.131] (inferred from 100% identity to ppu:PP_4826)

Predicted SEED Role

"Cobalamin biosynthesis protein CbiG / Cobalt-precorrin-3b C17-methyltransferase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.131

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DJ9 at UniProt or InterPro

Protein Sequence (565 amino acids)

>PP_4826 Precorrin-3B C17-methyltransferase (Pseudomonas putida KT2440)
MAGLNMHKAPAIVILGPGSLATAQRIQACYPQATIHGLEGRVEGADQSYASFGDTLRGLY
QQDTPIIALCAAGIVIRSLASLLSEKGSEPPVLAVAEDGSAVVPLLGGLGGVNVMAREIA
DALGVSAAITTSGELRFGTCLLNPPQGYALADIEQGKRFVSDLLAGESVRIEGNAPWLQL
AQLPASEAAQRTIHVGHQARPANRDELLIYPRLVVVGVAGGNLHSIRAALQQAGIAEPSV
ACVLADERTMADSALHEAAQALGVPLRFATCPGDVASMVAAAVPDSELIALGEVVVAVAS
APVDVAQVGRRRGRLAVIGLGPGAAELMVPAVKAELAQAEDVLGYETYVRMAGPFRGDQV
LHCTDNREEMQRARHAFELAAQGRSVAVVSSGDPGVFAMAAAVLEALHESSDPTWHRVDL
QILPGVSASLATAAQAGAPLGHDFCVMSLSDNLKPWSIIEKRLDLAAQADLVLAFYNPIS
KARPHQLGVALEVVRRHRDGNTPVVLGRDIGRPGQTLKVVTLAELLPEMVDMRTMVLVGS
STTCTFDRAAGGVWVYTPRWYGAKP