Protein Info for PP_4824 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 923 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 172 to 193 (22 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 30 to 158 (129 residues), 56.4 bits, see alignment E=7.9e-19 PF07695: 7TMR-DISM_7TM" amino acids 172 to 372 (201 residues), 80.2 bits, see alignment E=5.1e-26 PF00512: HisKA" amino acids 397 to 461 (65 residues), 71.9 bits, see alignment 9e-24 PF02518: HATPase_c" amino acids 509 to 623 (115 residues), 55.6 bits, see alignment E=1.8e-18 PF00072: Response_reg" amino acids 643 to 759 (117 residues), 71.6 bits, see alignment E=1.6e-23 amino acids 792 to 906 (115 residues), 78.4 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4824)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DK1 at UniProt or InterPro

Protein Sequence (923 amino acids)

>PP_4824 Sensor histidine kinase/response regulator (Pseudomonas putida KT2440)
MRRLRIASALIVSLLTLLCMFPAAAEHDGGWTVLLDEQANLQLSDVRSERYRNQFSPLPL
ADLDAAPAGQALWLHYRLAPGDQEQLLRVFAPDLSGLDLYALEGEQLLRQLHHGRQAGNA
SPTLRGSDHVLPLPNSRQPLDIYLRLVSEHQLRPAISLEPAAEAASDQRQPLLFGMLFGG
LIMLIMHNLIRFLYTRSSTTLILALYHGLMLLSGLILLNLSGPWWHVWHSAQTPAAYLTL
VLAGLSGLYFTQHFFSPCNSPRLNRLLQGEMLIVGLSGLVLLFVDTLPLNLMTYALMALG
SVSMLLVSSYHWYKGYAPGRLFSLAMVVFNLGGLVLLPALLGLTRTSTPWLLCILLGLTV
VSGLLLNLAVSERLRRISEERFSASRALAASDAEINAKAEFLAKISHEIRTPMNGVLGMT
ELLLGTPLSVKQRDYVQTIHSAGNELLTLINEILDISKLESRQIELDDVQFDLNALIEDC
LNIFRAKAEQQNIELISFTQPQVPRVISGDPTRLRQALSSLLENALKNTDQGEILLVVAL
DQRGEVPRLRIAVQDSGEPLPAADREALLQAELHSHHFLSSNKLGGHLGLVIAKQLIGLM
QGEFGIKSSTGMGNTLWLTLPLDPSRLEQPPADLDSPLRDARVLVVDDNDTCRKVLVQQC
SAWGMNVSAVPSGKEALALLRTKAHLRDYFDAVLLDQNMPGMTGMQLAAKIKEDPSLNHD
ILVVMLTGISNAPSKVIARNAGVKRILAKPVAGYTLKTTLAEELAQRGREQAMPASLPGI
PQALDLPGDFRVLVAEDNSISTKVIRSMLGKLNLKPDTACNGEEALQAMKAQHYDLVLMD
CEMPILDGFSATQQLRAWEAENQRQRTPVVALTAHILAEHKERARLAGMDGHMAKPVELS
QLRELIQYWANHREAKVDPAHTS