Protein Info for PP_4818 in Pseudomonas putida KT2440

Annotation: ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 40 to 329 (290 residues), 342.4 bits, E=6.6e-106
• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 41 to 323 (283 residues), 308.4 bits, E=2.6e-96
• PF05175: MTS
  • amino acids 180 to 267 (88 residues), 37.9 bits, E=3.7e-13
• PF13847: Methyltransf_31
  • amino acids 195 to 267 (73 residues), 32.1 bits, E=2.1e-11
• PF13649: Methyltransf_25
  • amino acids 199 to 249 (51 residues), 27.2 bits, 1.3e-09

Best Hits

Swiss-Prot: 100% identical to PRMA_PSEPK: Ribosomal protein L11 methyltransferase (prmA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 98% identity to ppg:PputGB1_4871)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q88DK7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PP_4818 ribosomal protein L11 methyltransferase (Pseudomonas putida KT2440)
MPGELLCSPRSTNPPHSRKLPAFAQPRAAPVDLSKVPAMPWLQVRLAISPEQAETYEDAL
LEVGAVSVTFMDAEDQPIFEPDLNTTPLWSHTHLLALFEANADPEQVFAHLRLLTGAELP
EHQAEVIEDQDWERSWMDNFQPMRFGRRLWIVPSWHDAPEKDAVNLLLDPGLAFGTGTHP
TTALCLEWLDGQQLEGTQVLDFGCGSGILAIAALLLGAREAVGTDIDVQAIEASRDNAQR
NGIADEKLALYLPEHMPAMQADVLVANILAGPLVSLAPQLSGLVRPGGLLALSGILAEQG
EDVAAAYAADFELDPIVVRDGWVRISGRRR