Protein Info for PP_4813 in Pseudomonas putida KT2440

Annotation: PAP2 family protein/DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 20 to 51 (32 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 107 to 123 (17 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details PF09335: SNARE_assoc" amino acids 39 to 163 (125 residues), 77.8 bits, see alignment E=9.9e-26 PF01569: PAP2" amino acids 287 to 399 (113 residues), 78.5 bits, see alignment E=4.1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4813)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DL2 at UniProt or InterPro

Protein Sequence (438 amino acids)

>PP_4813 PAP2 family protein/DedA family protein (Pseudomonas putida KT2440)
MGQWLDSLTGWLSANPQWLGLAIFLVACIECLAIAGIIVPGTVLLFAVAVLAGNGTFSLG
ETLLLGFLGGLLGDAMSYAVGKYFHQNIRRLPLLRHHPEWIGSAESYFQRYGIASLLVGR
FIGPLRPMLPMVAGMFDMPLPRFIAVSLLAGAGWSVAYLLPGWATGAAMRLPLPEGFWLD
AGIIAGALAVLIGLSLNTSLRDQRHGTRLVAALSFIALAGVFLGWPYFHEFDQGVMTLVQ
EHRSQAIDGTVVLVTRLGDFRTQLFLGALLTGLLLLARQWRHAFFAAGALMGTAIANGTL
KWLFARARPEVLTDPLTSYSMPSGHSSASFAFFLVMAVLAGRGQPPRMRLTWVMLGCIPA
LAIALSRVYLGAHWPTDILAGALLACCVCALSLTLVQRQQTLPALPLRVWWLVLPACVAL
LAFFAMHALPQALVRYQY