Protein Info for PP_4800 in Pseudomonas putida KT2440

Annotation: Lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00510: lipoyl synthase" amino acids 48 to 332 (285 residues), 424.9 bits, see alignment E=8.5e-132 PF16881: LIAS_N" amino acids 50 to 89 (40 residues), 32.1 bits, see alignment 1.3e-11 PF04055: Radical_SAM" amino acids 104 to 267 (164 residues), 83.5 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 100% identical to LIPA_PSEPK: Lipoyl synthase (lipA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 99% identity to ppg:PputGB1_4853)

MetaCyc: 64% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DM5 at UniProt or InterPro

Protein Sequence (338 amino acids)

>PP_4800 Lipoyl synthase (Pseudomonas putida KT2440)
MTTVQEAVPNLIPTQDATPRPAPKKVEAGVKLRGADKVARIPVKIIPTDELPKKPDWIRV
RIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVG
HGRPKPLDLDEPKNLAVAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRALSPGVQ
LETLVPDYRGRMDVALEITAQEPPDVFNHNLETVPRLYKAARPGSDYDWSLDLLQKFKQL
VPHVPTKSGLMLGLGETDEEVIEVMHRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTF
AWFAEEGYKMGFKNVASGPLVRSSYHADQQAHEAKIKL