Protein Info for PP_4799 in Pseudomonas putida KT2440

Annotation: putative Muramoyltetrapeptide carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF02016: Peptidase_S66" amino acids 22 to 136 (115 residues), 134 bits, see alignment E=2.8e-43 PF17676: Peptidase_S66C" amino acids 186 to 296 (111 residues), 117.9 bits, see alignment E=4.1e-38

Best Hits

KEGG orthology group: K01297, muramoyltetrapeptide carboxypeptidase [EC: 3.4.17.13] (inferred from 100% identity to ppu:PP_4799)

Predicted SEED Role

"Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13)" (EC 3.4.17.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DM6 at UniProt or InterPro

Protein Sequence (312 amino acids)

>PP_4799 putative Muramoyltetrapeptide carboxypeptidase (Pseudomonas putida KT2440)
MYCAKTFQPTLPAALPANACFAIVAPAGAARLDAHKVSQWFVDRGYRCRIYPGALQAQGY
LAGPDQQRLQDLHAAFADPAMDAILCMRGGYGSMRLLDQLDFELIRRNPKPLIGYSDITA
LHTAIYRHAGLVTFHGGMLNADLLGAKLPPTESSLLAQLGGHVRAGEQVAHPAGFALDCV
LPGVASGPLLGGNLSMLGATMGTLAELDTQGCILFIEDVNEPLYRVDRLLTQLRLAGKLE
GVKGVLVGDFAGITTAALTPLLEDTFAPLGVPVLAGWRSGHCDPNVCLPLGARVRLDSVQ
QTLVLEQDLFRA