Protein Info for PP_4796 in Pseudomonas putida KT2440

Annotation: DNA polymerase III, delta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR01128: DNA polymerase III, delta subunit" amino acids 16 to 336 (321 residues), 398.8 bits, see alignment E=8.7e-124 PF06144: DNA_pol3_delta" amino acids 20 to 128 (109 residues), 67.8 bits, see alignment E=1.4e-22 PF21694: DNA_pol3_delta_C" amino acids 214 to 318 (105 residues), 31.4 bits, see alignment E=2.5e-11 PF14840: DNA_pol3_delt_C" amino acids 216 to 341 (126 residues), 61.8 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: K02340, DNA polymerase III subunit delta [EC: 2.7.7.7] (inferred from 99% identity to ppg:PputGB1_4849)

Predicted SEED Role

"DNA polymerase III delta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DM9 at UniProt or InterPro

Protein Sequence (345 amino acids)

>PP_4796 DNA polymerase III, delta subunit (Pseudomonas putida KT2440)
MKLAPAQLNKHLQGALAPVYVVSGDDPLLCQEAADAIRNAARQQGFDERQVFSADANFDW
GTLLQAGASLSLFAQRRLLELRLPSGKPGDKGAAALMEYCANPAEDTLLLISLPKLDSSA
QKTKWGKALIEGAHCQFIQIWPVDVHQLPQWINQRLQQAGLSAQRDAVDLIAARVEGNLL
AAAQEIEKLKLLAEGSQITVETVQAAVADSARFDVFGLVDAILNGEAAHALRMLEGLRGE
GVEPPVILWALARELRQLAGLAQQFSQGVPLDKAFSQARPPIWDKRRPLVSKALQRLSAQ
RWAQLLQDAQRIDAQIKGQAEGSPWIGLARLSLLMAGQRLALPPE