Protein Info for PP_4782 in Pseudomonas putida KT2440

Annotation: Phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF08543: Phos_pyr_kin" amino acids 17 to 253 (237 residues), 240 bits, see alignment E=1.4e-75

Best Hits

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 100% identity to ppf:Pput_4658)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DP2 at UniProt or InterPro

Protein Sequence (265 amino acids)

>PP_4782 Phosphomethylpyrimidine kinase (Pseudomonas putida KT2440)
MNTYSSRPVVLCLSGHDPSGGAGLQADIEALIAQGCHAAPAVTALTVQDTVNVSDFRVLD
REWVLAQANAVLADSTVAAVKLGMLGSIEMVDTVAELLAAHPHLPLVCDPVLRAGGGGRL
GKDEVGYALRERLLPLATIATPNLPEARILAELPEGTADECAEKLLPFCRHLLITGGHGD
EDEIHNRLYTQDGQHFTWTCQRLPGSYHGSGCTLASALAGRLALGEQLESAVRTALDYTW
RTLRDAEQLGKGQYVPRRLPLDFCS