Protein Info for PP_4771 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details PF06790: UPF0259" amino acids 53 to 211 (159 residues), 55.7 bits, see alignment E=3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4771)

Predicted SEED Role

"FIG00958173: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DQ2 at UniProt or InterPro

Protein Sequence (218 amino acids)

>PP_4771 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MNPLSVLRDSLYFFRRHLPNILQLCLPLVVVEALLTQLLDRQLGDQASPAYGMLVSLLFY
PLYSAALILYLDTRSNGQEIAKRDLFARALQLWPQLALLILISSLLIMAGLALFIFPGVW
IMINLVFAEYLLVLRGRPVVQAMRESASMTTGHFMRIMICVLGVLAPIWLIDGLLLMAFP
EPSPGMELAMDSLSGFLQLFSTVVLYRLFMLLEGEAST