Protein Info for PP_4766 in Pseudomonas putida KT2440

Annotation: ATP-dependent RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF04851: ResIII" amino acids 24 to 190 (167 residues), 33.3 bits, see alignment E=7e-12 PF00270: DEAD" amino acids 25 to 194 (170 residues), 165.7 bits, see alignment E=1.2e-52 PF00271: Helicase_C" amino acids 231 to 339 (109 residues), 102.4 bits, see alignment E=2.5e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4766)

MetaCyc: 40% identical to ATP-dependent RNA helicase RhlB (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase PA3950" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DQ7 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PP_4766 ATP-dependent RNA helicase (Pseudomonas putida KT2440)
MNFAKLGLIEPLLRTLQQLDYTTPTPVQAKAIPAVLAGRDLMAAAQTGTGKTAGFALPVL
QRLALEGEKVASNSIRALVLVPTRELAEQVHNNVREYAENLPLTTYAVYGGVSINPQMMR
LRRGVDLLVATPGRLLDLFRQNAVKFNQVQTLVLDEADRMLDLGFAEELQSVYAALPRKR
QTLLFSATFSDQIRMLAGLALNDPLSIEVSPRNATAASVKQWLVPVDKKRKADLFCHLLR
KQRWKQVLVFAKTRNGVDQLVERLLAEGVNADGIHGDRPQATRQRALDSFKAREVQVLVA
TDVAARGLDIDDLPLVVNLDLPIVAEDYVHRIGRTGRAGNKGEAISLVCADEVQLLAAIE
VLTRQTLPRHEEPDFIPEHRVPMTDASGQVIKKPKKPKKPKENSAKRGLGRWMDSTEAAS
AEPAVKAVRKVPSFNGGPRKRKP