Protein Info for PP_4762 in Pseudomonas putida KT2440

Annotation: Acyl-CoA thioesterase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR00189: acyl-CoA thioesterase II" amino acids 12 to 283 (272 residues), 307 bits, see alignment E=6.3e-96 PF13622: 4HBT_3" amino acids 34 to 109 (76 residues), 77.4 bits, see alignment E=1.2e-25 PF20789: 4HBT_3C" amino acids 152 to 282 (131 residues), 87.3 bits, see alignment E=1.7e-28 PF02551: Acyl_CoA_thio" amino acids 156 to 281 (126 residues), 106.6 bits, see alignment E=1.4e-34

Best Hits

Swiss-Prot: 50% identical to TESB_ECOLI: Acyl-CoA thioesterase 2 (tesB) from Escherichia coli (strain K12)

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 100% identity to ppu:PP_4762)

MetaCyc: 50% identical to acyl-CoA thioesterase II (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]; 3.1.2.- [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DR1 at UniProt or InterPro

Protein Sequence (289 amino acids)

>PP_4762 Acyl-CoA thioesterase II (Pseudomonas putida KT2440)
MSHVLDDLVDLLSLESIEENLFRGRSQDLGFRQLYGGQVLGQSLSAASQTVEDARHVHSL
HGYFLRPGDASLPVVYSVDRVRDGGSFSTRRVTAIQKGQTIFTCSASFQYDEEGFEHQAQ
MPDVVGPENLPTEVELAHAMADQLPERIRDKVLCAKPIEIRPVTERDPFNPKPGDPVKYA
WFRADGNLPDVPALHKYMLAYASDFGLLTTALLPHGKSVWQRDMQIASLDHSLWFHGNLR
ADQWLLYATDSPWAGNSRGFCRGSIFNQAGQLVASSSQEGLIRHRKDWA