Protein Info for PP_4752 in Pseudomonas putida KT2440

Annotation: putative Xaa-Pro aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF01321: Creatinase_N" amino acids 55 to 202 (148 residues), 32.9 bits, see alignment E=8.7e-12 PF00557: Peptidase_M24" amino acids 211 to 418 (208 residues), 98.3 bits, see alignment E=5.4e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4752)

Predicted SEED Role

"Aminopeptidase YpdF (MP-, MA-, MS-, AP-, NP- specific)" in subsystem Protein degradation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DS1 at UniProt or InterPro

Protein Sequence (435 amino acids)

>PP_4752 putative Xaa-Pro aminopeptidase (Pseudomonas putida KT2440)
MQTGSDSIELLTALTERDLRFRSDAKVTEHAIAPVDTALLEAYAAIDRKALRHYRLERIR
EQLRAQDYAGILLADPINIRYATDTNNLGLWVMHSPSRYVFVATDGPVVLFEFTSSQHNS
EHVETIDEIRPAIPWLYFLAGPRVQEKAERWAQEVADLMARHGGGNRRLAVDRCDPWGAQ
RLTHQGIELFDAQPLMEQARLIKSAEEVASHRVSMGVCDLAIARMRTSLVPGVTENQLWS
IMHGTNVAHGGEWAESRLLSSGPRTNPWFQDATDKVIKAGEMVCFDTDMVGPGGYLSDIS
RSFICPGKAPTMAQRDLLDIASQQINHNVELLRPGLSFREFAERCWPVPQRFEHNRYMMM
LHGVGLVDEYPSVAYAVDFAEWGYDGLFQENMVVSVESYIGEQGGGEGVKLEEQVLISAN
GPIKLSRTPLVDGDR