Protein Info for PP_4735 in Pseudomonas putida KT2440

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 116 to 150 (35 residues), see Phobius details amino acids 153 to 186 (34 residues), see Phobius details amino acids 191 to 191 (1 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 328 to 330 (3 residues), see Phobius details amino acids 332 to 346 (15 residues), see Phobius details amino acids 349 to 351 (3 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details amino acids 434 to 459 (26 residues), see Phobius details amino acids 531 to 550 (20 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 7 to 547 (541 residues), 755.3 bits, see alignment E=2e-231 PF02652: Lactate_perm" amino acids 16 to 544 (529 residues), 706.8 bits, see alignment E=9.9e-217

Best Hits

Swiss-Prot: 77% identical to GLCA_ECOLI: Glycolate permease GlcA (glcA) from Escherichia coli (strain K12)

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 100% identity to ppf:Pput_4601)

MetaCyc: 77% identical to glycolate/lactate:H+ symporter GlcA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-104; TRANS-RXN-105; TRANS-RXN0-515; TRANS-RXN0-622

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DT4 at UniProt or InterPro

Protein Sequence (556 amino acids)

>PP_4735 L-lactate permease (Pseudomonas putida KT2440)
MQTWQQLYSPLGSLGLSALAAVIPIVFFFLALAVFRLKGHVAGSITLALSILVAIFAFQM
PVDMALAAAGYGFLYGLWPIAWIIVAAVFLYKLTVKSGQFEVIRSSVLSITDDQRLQVLL
IGFCFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGALGIPIIVA
GQVTGIDAFHIGAMTGRQLPLLSLFVPFWLVFMMDGLRGVKETWPAALVAGLSFAVTQYF
TSNFIGPELPDITSALASLICLTLFLKVWQPKRAFSEAKGSVGAAVVQPSGSQPSPYSFG
EIFKAWSPFLILTVLVTIWTLKPFKAAFAPGGAMYNFVFNFAIPHLDQLVIKTAPIVAAP
TAMPAVFKLDPISATGTAIFLSALISMAVLKINFKTGLTTFKETFWELRWPILSIGMVLA
FAFVTNYSGMSSTMALVLAGTGAAFPFFSPFLGWLGVFLTGSDTSSNALFSSLQATTAHQ
IGVNDTLLVAANTSGGVTGKMISPQSIAVACAATGLVGKESDLFRFTVKHSLFFATIVGL
ITLVQAYWLTGMLVHH