Protein Info for PP_4729 in Pseudomonas putida KT2440

Annotation: factor used in recombination and DNA repair

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 TIGR00634: DNA repair protein RecN" amino acids 1 to 552 (552 residues), 538 bits, see alignment E=1.8e-165 PF13476: AAA_23" amino acids 5 to 152 (148 residues), 30.6 bits, see alignment E=5.4e-11 PF02463: SMC_N" amino acids 5 to 512 (508 residues), 55.6 bits, see alignment E=5.1e-19

Best Hits

Swiss-Prot: 40% identical to RECN_XYLFA: DNA repair protein RecN (recN) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K03631, DNA repair protein RecN (Recombination protein N) (inferred from 100% identity to ppu:PP_4729)

Predicted SEED Role

"DNA repair protein RecN" in subsystem DNA-replication or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DU0 at UniProt or InterPro

Protein Sequence (557 amino acids)

>PP_4729 factor used in recombination and DNA repair (Pseudomonas putida KT2440)
MLVHLSIHNYAIVEHLDLEIARGMSVITGETGAGKSIMLDALGLALGDRADSGVVRPGTD
KADILATFDLVDIPEAHTWLAERDLDNEGLCILRRVITAEGRSRGYINGTPCPLGDLKAL
GELLIDIHSQHEHQSLLKTDTHRRLLDEYAGAVDLARQVQLAAKRWNQTRLELERLSNSG
DEQRARHQLLSYQLEELDNLGLGEHELEQLEQEHKNLTSAEALFGICRQVIDQCSESDSG
NVLSALTSSLNRLGAATNSPKALSEAANLIASAQIQVEEAVGELNRFLDNFDADPIRLQA
LEERLDTIYTLARKHRVHPTELPHLQQQLMEELEGLNASDESIERLGEELAAYAQHYKEK
ARELSGLRQQAAQQLAGAVEQEIQRLGMPGGRFCIELTANEGTELSPHGLEQIELLVSAN
PGQPLKALAKVASGGELSRISLAIQVITAQTSRIPTLVFDEVDVGIGGPTAEIVGQLLRR
LGERGQVLTVTHLPQVAAQGHHHLFVHKVRNSDTTHTAVASLGKRERVEEVARMLGGIDL
TKESLAHARKMVVSGKA