Protein Info for PP_4726 in Pseudomonas putida KT2440

Annotation: Chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR02349: chaperone protein DnaJ" amino acids 5 to 349 (345 residues), 466.7 bits, see alignment E=3e-144 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 96.3 bits, see alignment E=1.8e-31 PF01556: DnaJ_C" amino acids 120 to 333 (214 residues), 179.6 bits, see alignment E=8.3e-57 PF00684: DnaJ_CXXCXGXG" amino acids 147 to 207 (61 residues), 60.8 bits, see alignment E=2.5e-20 PF27439: DnaJ_C_2" amino acids 339 to 374 (36 residues), 34.5 bits, see alignment 3.4e-12

Best Hits

Swiss-Prot: 100% identical to DNAJ_PSEPK: Chaperone protein DnaJ (dnaJ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to ppu:PP_4726)

MetaCyc: 67% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DU3 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PP_4726 Chaperone protein DnaJ (Pseudomonas putida KT2440)
MSKRDYYEVLGVERGATEADLKKAYRRLAMKYHPDRNPGDKESEDKFKEANEAYEVLSDA
SKRAAFDQYGHAGVDPSMGGGGAGFGGANFSDIFGDVFSDFFGGGGRGGGRGGAQRGSDL
RYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSGAKKGSTPSTCPTCGGIGQVRMQQGFF
SVQQTCPRCHGQGKIITDPCTSCHGEGRVEEYKTLSVKVPAGVDTGDRIRLSGEGEAGTH
GGPTGDLYVVISVREHEIFQRDGKHLYCEVPISYTDAALGGELEVPTLDGRVKLKIPEGT
QTGKQFRLRGKGVAPVRGGGAGDLLCRVAVETPVNLSRRQRELLEELRDSLEGDSSHSPK
ASGWFDGVKRFFGDL