Protein Info for PP_4724 in Pseudomonas putida KT2440

Annotation: Carbamoyl-phosphate synthase small chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 5 to 375 (371 residues), 474.5 bits, E=9.8e-147
• PF00988: CPSase_sm_chain
  • amino acids 7 to 132 (126 residues), 178.4 bits, E=7.5e-57
• PF00117: GATase
  • amino acids 196 to 372 (177 residues), 179.8 bits, E=7.1e-57
• PF07722: Peptidase_C26
  • amino acids 250 to 285 (36 residues), 24 bits, 4.7e-09

Best Hits

Swiss-Prot: 100% identical to CARA_PSEPK: Carbamoyl-phosphate synthase small chain (carA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 100% identity to ppf:Pput_4590)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis III (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

See Q88DU5 at UniProt or InterPro

Protein Sequence (378 amino acids)

>PP_4724 Carbamoyl-phosphate synthase small chain (Pseudomonas putida KT2440)
MTKPAILALADGSIFRGEAIGADGQTVGEVVFNTAMTGYQEILTDPSYAQQIVTLTYPHI
GNTGTTPEDAESSRVWSAGLVIRDLPLLASNWRNTQSLPEYLKANNVVAIAGIDTRRLTR
ILREKGAQNGCILAGDNISEEAAIAAARGFPGLKGMDLAKVVSTKERYEWRSSVWELKTD
SHPTIDAADLPYHVVAFDYGVKLNILRMLVARGCRVTVVPAQTPASEVLALNPDGVFLSN
GPGDPEPCDYAIQAIKEILETEIPVFGICLGHQLLALASGAKTVKMGHGHHGANHPVQDL
DTGVVMITSQNHGFAVDEATLPGNVRAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGP
TDVAPLFDRFTDAMAKRR