Protein Info for PP_4722 in Pseudomonas putida KT2440

Annotation: Transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF03449: GreA_GreB_N" amino acids 7 to 76 (70 residues), 90.2 bits, see alignment E=8e-30 TIGR01462: transcription elongation factor GreA" amino acids 7 to 158 (152 residues), 173.6 bits, see alignment E=1.5e-55 PF01272: GreA_GreB" amino acids 85 to 158 (74 residues), 95.5 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 100% identical to GREA_PSEPK: Transcription elongation factor GreA (greA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 99% identity to pen:PSEEN0783)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DU7 at UniProt or InterPro

Protein Sequence (160 amino acids)

>PP_4722 Transcription elongation factor GreA (Pseudomonas putida KT2440)
MSITKYPMTVQGARALEEEHLFLSKTERPRLSQAIGEARELGDLKENAEYHAAREEQGMV
EARIRDIEGRLQNSVVIDVTTIPHTGKVIFGTTVVLANTETDEEVTYQIVGEDEADVKQG
KLSSGAPIARAIIGKEEGDTVVVKTPSGTVEYEIVEVKHI