Protein Info for PP_4696 in Pseudomonas putida KT2440

Annotation: Nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF00072: Response_reg" amino acids 4 to 109 (106 residues), 82.9 bits, see alignment E=6.3e-27 PF00158: Sigma54_activat" amino acids 152 to 318 (167 residues), 250.6 bits, see alignment E=2.3e-78 PF14532: Sigma54_activ_2" amino acids 153 to 323 (171 residues), 81 bits, see alignment E=3.8e-26 PF07728: AAA_5" amino acids 175 to 294 (120 residues), 35.8 bits, see alignment E=2.7e-12 PF25601: AAA_lid_14" amino acids 324 to 397 (74 residues), 69.8 bits, see alignment E=5.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4561)

Predicted SEED Role

"Two-component sensor CbrB: intrcellular carbon:nitrogen balance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88DX2 at UniProt or InterPro

Protein Sequence (480 amino acids)

>PP_4696 Nitrogen regulation protein NR(I) (Pseudomonas putida KT2440)
MPHILIVEDETIIRSALRRLLERNQYQVSEAGSVQEAQERFSIATFDLIVSDLRLPGAPG
TELIKLGQGTPVLIMTSYASLRSAVDSMKMGAVDYIAKPFDHDEMLQAVARILRDRQNAP
AAAPPAEPRASNGKATASDKGSAATANGEIGIIGSCQPMQDMYSKIRKVAPTDSNVLIQG
ESGTGKELVARALHNLSRRAKAPMISVNCAAIPETLIESELFGHEKGAFTGASAGRAGLV
EAADGGTLFLDEIGELPLEAQARLLRVLQEGEIRRVGSVQSQKVDVRLIAATHRDLKNLA
KAGQFREDLYYRLHVIALKLPALRERGSDVNEIANVFLARQSARIGRDDLHFSAEAEQAI
RHYSWPGNVRELENAVERAVILSESAEISAELLGIDIELSDLDEDDILDNALVVANAGNA
SHEPTEDLSLEDYFQHFVLEHQDHMTETELARKLGVSRKCLWERRQRLGIPRRKSNATSE