Protein Info for PP_4679 in Pseudomonas putida KT2440

Annotation: acetohydroxybutanoate synthase / acetolactate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 1 to 158 (158 residues), 211.1 bits, E=4.2e-67
• PF01842: ACT
  • amino acids 3 to 68 (66 residues), 56.1 bits, E=3.8e-19
• PF13710: ACT_5
  • amino acids 11 to 72 (62 residues), 53.9 bits, E=2e-18
• PF10369: ALS_ss_C
  • amino acids 84 to 157 (74 residues), 93.4 bits, E=1.1e-30

Best Hits

Swiss-Prot: 64% identical to ILVH_SALTY: Acetolactate synthase isozyme 3 small subunit (ilvH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 93% identity to avn:Avin_42510)

MetaCyc: 69% identical to acetohydroxyacid synthase subunit H (Cupriavidus necator H16)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See Q88DY9 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PP_4679 acetohydroxybutanoate synthase / acetolactate synthase (Pseudomonas putida KT2440)
MRHIISLLLENEPGALSRVVGLFSQRNYNIESLTVAPTEDPTLSRLTLTTVGHDEVIEQI
TKNLNKLVEVVKLVDLSESAHIERELMLVKVKATGAQRAEIKRTTDIFRGQIVDVTASVY
TVQLSGTSDKLDSFIQAIGTASILETVRSGVTGIARGDKVLSI