Protein Info for PP_4648 in Pseudomonas putida KT2440

Annotation: Ribosomal RNA large subunit methyltransferase G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF05175: MTS" amino acids 201 to 371 (171 residues), 176.5 bits, see alignment E=1.1e-55 PF06325: PrmA" amino acids 231 to 306 (76 residues), 34.9 bits, see alignment E=3.7e-12 PF13847: Methyltransf_31" amino acids 233 to 312 (80 residues), 37.9 bits, see alignment E=4.2e-13 PF13649: Methyltransf_25" amino acids 235 to 335 (101 residues), 29.7 bits, see alignment E=2.6e-10

Best Hits

Swiss-Prot: 100% identical to RLMG_PSEPK: Ribosomal RNA large subunit methyltransferase G (rlmG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to ppu:PP_4648)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E20 at UniProt or InterPro

Protein Sequence (374 amino acids)

>PP_4648 Ribosomal RNA large subunit methyltransferase G (Pseudomonas putida KT2440)
MPLLTTPYAELDLIRQPEQANDPLQAFDAADEYLLAQLHDQAPDANCRVLVLNDSFGALA
ASLAGQLQVVSSGDSHLGHLALEKNLARNGLPFDSVPFVPASEHWQGPFDRVLVRVPKTL
ALLEEQLIRLQGQLAPGAQVIAGAMIKHLPRAAGDLMEKYIGPVQASLALKKARLLTATV
AERPLAKSPYPSCYRLDAPALDLVNHANVFCREGLDIGTRAFLPHLPRNLGRARVADLGC
GNGVLAIASALANPEAEYTLVDESYMAVQSAQENWLAALGERPATFLAADGLAGLEKQSL
DVVLCNPPFHQQQVVGDFLAWRMFQQAREALVVGGALYIVGNRHLGYHSKLARLFRGVEQ
VAATPKFVILKARK