Protein Info for PP_4643 in Pseudomonas putida KT2440

Annotation: Xanthine/uracil permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details amino acids 355 to 372 (18 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 23 to 434 (412 residues), 351 bits, see alignment E=9.2e-109 PF00860: Xan_ur_permease" amino acids 24 to 403 (380 residues), 311.9 bits, see alignment E=2.7e-97 TIGR03173: xanthine permease" amino acids 26 to 436 (411 residues), 508.7 bits, see alignment E=1.1e-156

Best Hits

Swiss-Prot: 38% identical to NUCLP_PAELB: Nucleobase transporter PlUacP (PL1_3014) from Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4643)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E25 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PP_4643 Xanthine/uracil permease family protein (Pseudomonas putida KT2440)
MTTSPSTSPAKRPEDENLGLGANLAYGLQHVLTMYGGIVAVPLILGQAAGLNGAEIGMLI
AASLFAGGLATLLQTLGLPFFGCQLPLVQGVSFAGVATMGAILSSEGGGGLPGVLGAVMA
ASLIGFLITPVFSRITKFFPPLVTGIVITTIGLTLMPVAARWVMGGNSASPEFGSMANIG
LAALTFAIVLLLSKLGSATISRLSILLAMVVGTLIAWALGMTDFSKVGEGPMFAFPTPFH
FGMPEFHIAAILSMCIVIMVTLVETSADILAVGEIIDTKVDSKRLGNGLRADMASSILAP
IFGSFTQSAFAQNVGLVAVTGVKSRYVVATGGVILVVLGLLPVMGRVIAAVPTPVLGGAG
IVLFGTVAASGIRTLSKVSYKNNVNLIIVAASLGFGMIPIAAPTFYHHFPNWFETIFHSG
ISSAAIMAILLNLIFNHFTTGNSENQSVFAAAYERTIQYSDISALRDGDYFKDGKLFDAE
GNEVPMLELDEHGNETVRRTAVAEH