Protein Info for PP_4635 in Pseudomonas putida KT2440

Annotation: trans-2-enoyl-CoA reductase (NAD(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF12242: Eno-Rase_NADH_b" amino acids 3 to 81 (79 residues), 118.2 bits, see alignment E=1.6e-38 PF12241: Enoyl_reductase" amino acids 83 to 320 (238 residues), 360.5 bits, see alignment E=5.4e-112 PF07055: Eno-Rase_FAD_bd" amino acids 329 to 392 (64 residues), 107.6 bits, see alignment E=4.9e-35

Best Hits

Swiss-Prot: 100% identical to FABV_PSEPK: Enoyl-[acyl-carrier-protein] reductase [NADH] (fabV) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K10783, trans-2-enoyl-CoA reductase (NAD+) [EC: 1.3.1.44] (inferred from 100% identity to ppf:Pput_4497)

Predicted SEED Role

"Short-chain alcohol dehydrogenase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E33 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PP_4635 trans-2-enoyl-CoA reductase (NAD(+)) (Pseudomonas putida KT2440)
MAIIHPKVRGFICTTTHPKGCELNVRDQIEATRKLGVREDGPKKVLVIGASSGYGLAARI
TAAFGFKADTLGVFFEKPGTETKAGTAGWYNAAAFDKFAKAEGLYSKSINGDAFSDEARA
KVIELIKNEMGGKVDLVIYSLASPVRKLPQTGEVIRSALKPIGQPYKSTAIDTNKDTIIE
ASIEPATEQEIADTVTVMGGQDWQLWIDALAGANVLAEGARTVAFSYIGSDITWPIYWHG
ALGQAKQDLDETALRLNQKLAGEVKGGANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQE
KGVHEGTQDQLDRMYRDRMYRTDGAPAEVDEKGRLRLDDWELRDDVQNACKALWPQVTTE
NLFELTDYAGYKKQFLNLFGFERADVDYDKDVATDVKFDCVEL