Protein Info for PP_4613 in Pseudomonas putida KT2440

Annotation: outer membrane ferric citrate porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07660: STN" amino acids 54 to 102 (49 residues), 31.3 bits, see alignment 2.1e-11 TIGR01783: TonB-dependent siderophore receptor" amino acids 134 to 774 (641 residues), 408 bits, see alignment E=4.2e-126 PF07715: Plug" amino acids 134 to 246 (113 residues), 72.3 bits, see alignment E=6.7e-24 PF00593: TonB_dep_Rec" amino acids 338 to 741 (404 residues), 188.8 bits, see alignment E=5e-59

Best Hits

Swiss-Prot: 62% identical to FECA_ECOLI: Fe(3+) dicitrate transport protein FecA (fecA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_4613)

MetaCyc: 62% identical to ferric citrate outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1684

Predicted SEED Role

"Iron(III) dicitrate transport protein FecA @ Iron siderophore receptor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E55 at UniProt or InterPro

Protein Sequence (774 amino acids)

>PP_4613 outer membrane ferric citrate porin (Pseudomonas putida KT2440)
MPLRPNPFVHALLLTTTLGLAMPAAQAETRSYHIAAGSLEDALNQFGRESGALISFGSQL
TQGMSTQGLDGQYDTRQGLDALLRGSGLQARQETDNAFSLQPITAPAAGAAVELGASTVV
GDWLAEAQQDNVFEHPGARDVVRREEFERNGATTAREVLNRIPGVNAPDNNGTGSHDLAL
NFGIRGLNPRLASRSTVLMDGIPVPFAPYGQPQLSLAPLSMGNMDAVDVVRGGGAVRYGP
QNVGGIVNFVTRAIPEQATFKAAMQNQISPSSSHEGFKNSANLLVGGTNDNGLGGALLYS
GTRGGDWREHSDTQIDDLILKGKLQLDEANSLHAMAQYYEGEADMPGGLSTADFDADPYQ
STRLKDKFWGRRTLFNFGYDYKQDDRQFSVNSFFTKTLRSGYLDQGSFVSLSPREYWVRG
IETRFSQGVALGDSWHELGIGYRYVNEAGHELRFREPVNGSLPTTASRNDRDTRGSTEAH
AIYLDDRIDIGRWTITPGVRYEMIDSEQSNKLNGQRYQGSYNTALPALNVMYHLTDSWNL
YANTEGSFGSVQYSQMPNRVSSGEVKPEKARTWEVGTRYDNGDLQAEIGAFLINFDNQYE
SNQTNDSVIARGETRHQGIETSVRYALDGLSPALAGFDVHASYAFVDATIREDGPNKGNQ
VPFSSRHKGNLGVGYTEGPWQLNLDGSFQSSQYADNANTSTESADGSTGRIPGYMLVSTR
AGYDFGPQLSNLKVAVGVKNLFNREYYTRSYDDNNKGKYVGEPRTLYLQTSVEF