Protein Info for PP_4610 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function containing PepSY-associated TM helix domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 317 to 334 (18 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 445 to 462 (18 residues), see Phobius details amino acids 476 to 496 (21 residues), see Phobius details PF03929: PepSY_TM" amino acids 10 to 363 (354 residues), 229.8 bits, see alignment E=3.4e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4610)

Predicted SEED Role

"FIG138928: iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E58 at UniProt or InterPro

Protein Sequence (525 amino acids)

>PP_4610 conserved protein of unknown function containing PepSY-associated TM helix domain (Pseudomonas putida KT2440)
MKEGFRQAMAWLHTWTGLIFGWLLFAIFLTGTLSYFKEEITHWSQPEVRSHALDPINSLA
VAQRYLQDNAGHSSTWFIRMPNEREAALSVGYRDPSGGPRGFVRKTLDTQTGQPVEARDS
RGGEFFYRFHFQLQMPYPVGRWLSTFCAFIMLLGLVTGIITHKKIFKEFFTFRPGKGQRS
WLDGHNAIGVLVLPFHLMISYSSLVLFMYMVMPAGIMASYGNDTDKYFNDLFGRNDAPKA
AQVATPLVALPSLYAKVQELQPGARVGNIQVQNPGDSNARVTFTQSAADHVAYRRSANWT
FDGASGALLSQGKPESGVMMTAFSFAGLHMGNFAGPWLRWLYFFFGVAGTAVIGTGLVMW
LGKRQLKHAKNGHMPGELRLVEVLNIASMSGLLLAVASFFWANRLVPMAVEGRADWEVNA
FFIAWGLSLVHAVLRSGRKAWGEQLALGALAFALLPLLNGLTTDRGLNHSVLEGDWAMAG
FDLTALGTGLFLAWLARKMLVSPTPVAKRAARAAKKPSIETLGAS