Protein Info for PP_4597 in Pseudomonas putida KT2440

Annotation: Cyclic pyranopterin monophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 8 to 334 (327 residues), 375.4 bits, see alignment E=1.1e-116 PF04055: Radical_SAM" amino acids 21 to 182 (162 residues), 123.7 bits, see alignment E=1.4e-39 PF13353: Fer4_12" amino acids 26 to 112 (87 residues), 24 bits, see alignment E=6.5e-09 PF06463: Mob_synth_C" amino acids 188 to 317 (130 residues), 131.7 bits, see alignment E=2.4e-42

Best Hits

Swiss-Prot: 100% identical to MOAA_PSEPK: GTP 3',8-cyclase (moaA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to ppf:Pput_1291)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88E69 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PP_4597 Cyclic pyranopterin monophosphate synthase (Pseudomonas putida KT2440)
MEQNSRALIDGFNRKIDYLRMSVTDRCDFRCVYCMAEDMQFLPRQQILSLEELFQVAERF
VALGTRKIRLTGGEPLVRQGIVDLCGRIAALPGLRELCLTSNGSQLGRLAQPLFDAGVTR
LNISLDSLDADRFKQLTRTGDLAQVIAGIDAARQAGFKRTKLNCVVLKGRNDHELVDLVR
FAIERELDITFIEEMPLGVISEHERGESFCSSDEVRARLAEQFTLVESTESSMGPARYWR
LAEAANTRVGFISPHSHNFCATCNRVRLTVEGRLLLCLGNEHSVDLKHVLRAHPGNPERL
EKAIRDSLHLKPYRHHFEVGGDVQILRFMNMTGG