Protein Info for PP_4560 in Pseudomonas putida KT2440

Annotation: putative Ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 18 to 275 (258 residues), 150.3 bits, see alignment E=4.5e-48 PF03631: Virul_fac_BrkB" amino acids 24 to 277 (254 residues), 241.8 bits, see alignment E=5.2e-76

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to ppf:Pput_1329)

Predicted SEED Role

"Inner membrane protein YihY, formerly thought to be RNase BN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EA6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PP_4560 putative Ribonuclease BN (Pseudomonas putida KT2440)
MIFPDLRGLPLHRVLVRTVKEFLDDEMSTYASALAYQALFSLFPFLLFLIALIGFLHLPD
FFSWLRLQSELVLPPQALEQVNPVIDQLQQSKGGLLSVGIVIALWTASAGVRLMMSAMNA
AYDVSEGRPVWKRIPLSIFYTVGLAGMLLAAAALMVLGPQVMEWIAAQIGMQEFIVTLWT
ILRWPVIIILLMVAVALIYYVMPDVKQQFRFITPGSVLAVVVWIVASLGFAYYVKTFADY
NAMYGSIGAIIVLLLYFYISAAVLLLGAEMNAVIEHMSAEGKNPGEKDFDGEKPKETLTV
LGHEHPNPSKPHSVEPNP