Protein Info for PP_4548 in Pseudomonas putida KT2440

Annotation: putative Oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF01266: DAO" amino acids 37 to 390 (354 residues), 227 bits, see alignment E=1.1e-70 PF12831: FAD_oxidored" amino acids 37 to 116 (80 residues), 27.3 bits, see alignment E=4.7e-10 PF00890: FAD_binding_2" amino acids 37 to 75 (39 residues), 26 bits, see alignment 1.1e-09 PF13450: NAD_binding_8" amino acids 40 to 76 (37 residues), 22.6 bits, see alignment 2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4548)

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49)" in subsystem Methionine Biosynthesis (EC 2.5.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.49

Use Curated BLAST to search for 2.5.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EB8 at UniProt or InterPro

Protein Sequence (435 amino acids)

>PP_4548 putative Oxidoreductase (Pseudomonas putida KT2440)
MNAALNNGPAQRAPSYYSATLNDHTAYPQLKGTVQVDVAIIGGGFTGVATAVELAERGLK
VAIVETNRIGWGASGRNGGQVTGSLSGDEAMRSQMRNHLGAEVDDFIWHLRWRGHQVIEQ
RVARYGIDCDLKRGHLHAAMKPSHMNELRAFEAEARRRGMGDQVQLLDRAAVAEHLQSPL
YLGALKNLRNLHLHPLNLCLGEARAAHGLGALIFENSEVLDIVHGPRPAVVTAHGRVEAR
QVMLAGDVYHKLEKRQLKGKIFPAMGGIVTTAPLGELAEQINPQDLAVYDCRFVLDYYRL
TADKRLLFGGGANYSGKDSRDIEGELRPCIERTFPALKGVPIEFQWSCAMGIVVNRIPQL
GKLSDNVWYCQGYSGHGIATSHIMGEIMAEALTGTLEKFDTFAQCRHVRVPMGDLLGNPL
LAAGMWYYQMLEKLR