Protein Info for PP_4538 in Pseudomonas putida KT2440

Annotation: FMN-dependent NADH-azoreductase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF02525: Flavodoxin_2" amino acids 3 to 197 (195 residues), 189.5 bits, see alignment E=5.8e-60 PF03358: FMN_red" amino acids 3 to 169 (167 residues), 50.3 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 100% identical to AZOR2_PSEPK: FMN-dependent NADH-azoreductase 2 (azoR2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 100% identity to ppf:Pput_1353)

MetaCyc: 48% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EC8 at UniProt or InterPro

Protein Sequence (199 amino acids)

>PP_4538 FMN-dependent NADH-azoreductase 2 (Pseudomonas putida KT2440)
MSRVLIIESSARQQDSVSRQLTKDFIQQWQAAHPADQITVRDLAVSPVPHLDANLLGGWM
KPEEQRSAAELEALARSNELTDELLAADVLVMAAPMYNFTIPSTLKAWLDHVLRAGITFK
YTPTGPQGLLTGKRAIVLTARGGIHAGASSDHQEPYLRQVMAFIGIHDVDFIHAEGLNMS
GEFHEKGVNQAKAKLAAVA