Protein Info for PP_4526 in Pseudomonas putida KT2440

Annotation: putative MFS superfamily transporter precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 64 (25 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 272 to 306 (35 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details PF06779: MFS_4" amino acids 14 to 372 (359 residues), 452.9 bits, see alignment E=1.1e-139

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4526)

Predicted SEED Role

"Possible MFS Superfamily transporter precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ED9 at UniProt or InterPro

Protein Sequence (390 amino acids)

>PP_4526 putative MFS superfamily transporter precursor (Pseudomonas putida KT2440)
MSPLIQLLASAVALMMAMGIGRFALTPQLPQLIAEGQFDLTVAGLVAAANYLGYFVGAVD
AMFARSPGQVRRRLHGGLWLCVLLTLASWAANGFWGHLLLRFGTGVASAWVLVMITSLSQ
QVATAHNRQRLGALVFAGPGLGIAVTGLLALVAHVLGLGSAALWLIYAVAALVMLLAVRP
WLPRALQAAPTQSPVRQGPTRNVGTGRLGLVYGLYGMGYILPATFLSQMANQQFRGQWLA
DLFWPAFGLAAALGVLLVSVRRDGRTSTWLTATLWLQGLGVLACLMGGGIGLALGVALCG
GPFLACMQLVMQRSRELAPQATQRNAGLLTACFALGQLSGPLLAALSSHYSGGLQPALML
AAGGLVVAGGLVQLPGDAQQGSACQAKVAS